PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C016901P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Nin-like
Protein Properties Length: 124aa    MW: 14456.9 Da    PI: 11.3753
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C016901P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK73.42.9e-233279451
          RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51
                    +++++dl++y +lpi +AAk++++clTv+K+iCR+ G++RWP+Rk+ks
  MELO3C016901P1 32 RMTVNDLKEYLHLPISEAAKKMNLCLTVVKKICRRSGLRRWPYRKVKS 79
                    7899*******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.09720100IPR003035RWP-RK domain
PfamPF020422.0E-203379IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MVVHRNRVKQ SDSVFPFLFF KSQSEQRQRA GRMTVNDLKE YLHLPISEAA KKMNLCLTVV  60
KKICRRSGLR RWPYRKVKSY QRKMGALGTR LRSRDAETRA RAEAEMERLR QELAQFCAGI  120
VPD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818611e-125LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132611e-125LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141337.25e-63PREDICTED: uncharacterized protein LOC101213670
TrEMBLA0A0A0L2U89e-65A0A0A0L2U8_CUCSA; Uncharacterized protein
STRINGBra008646.1-P7e-29(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.16e-11RWP-RK domain-containing protein